Structure of PDB 6acl Chain A Binding Site BS01

Receptor Information

>6acl Chain A (length=267) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDL
ATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRV
VVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALS
GKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEV
DRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRF
RFHFQGPCGTTLPEALA

Ligand information

>6acl Chain B (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ELNKLLGRVT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6acl complex structure of histone lysine desuccinylase Sirt5 with succinyl peptide H2AK95
Resolution	1.92 Å
Binding residue (original residue number in PDB)	R71 Y102 R105 I142 V221 F223 E225 N226 L227 V253 V254 Y255 P256
Binding residue (residue number reindexed from 1)	R36 Y67 R70 I107 V186 F188 E190 N191 L192 V218 V219 Y220 P221

Enzymatic activity

Catalytic site (original residue number in PDB)	P68 T69 F70 R71 N141 D143 H158
Catalytic site (residue number reindexed from 1)	P33 T34 F35 R36 N106 D108 H123
Enzyme Commision number	2.3.1.-

Gene Ontology

	Molecular Function
GO:0036054	protein-malonyllysine demalonylase activity
GO:0036055	protein-succinyllysine desuccinylase activity
GO:0070403	NAD+ binding

View graph for
Molecular Function

External links

PDB	RCSB:6acl, PDBe:6acl, PDBj:6acl
PDBsum	6acl
PubMed
UniProt	Q9NXA8\|SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial (Gene Name=SIRT5)

[Back to BioLiP]