Structure of PDB 6aax Chain A Binding Site BS01

Receptor Information
>6aax Chain A (length=290) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QNFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGGITRSILNADVAELLVV
EKDTRFIPGLQMLSDAAPGKLRIVHGDVLTFKVEKAFSESLKRPWEDDPP
NVHIIGNLPFSVSTPLIIKWLENISCRDGPFVYGRTQMTLTFQKEVAERL
AANTGSKQRSRLSVMAQYLCNVRHIFTIPGQAFVPKPEVDVGVVHFTPLI
QPKIEQPFKLVEKVVQNVFQFRRKYCHRGLRMLFPEAQRLESTGRLLELA
DIDPTLRPRQLSISHFKSLCDVYRKMCDEDPQLFAYNFRE
Ligand information
>6aax Chain B (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguaaguguacuggaaagugcacuugcc
<<<<<<<<<<<<....>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6aax Structural insights into dimethylation of 12S rRNA by TFB1M: indispensable role in translation of mitochondrial genes and mitochondrial function.
Resolution2.994 Å
Binding residue
(original residue number in PDB)		N36 N141 L142 F144 I152 Q177 E179 V180 R183 R195 L196 M199 F217 P221 V223 E246 R256 R257
Binding residue
(residue number reindexed from 1)		N2 N107 L108 F110 I118 Q143 E145 V146 R149 R161 L162 M165 F183 P187 V189 E212 R222 R223
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0000179 rRNA (adenine-N6,N6-)-dimethyltransferase activity
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0034246 mitochondrial transcription factor activity
GO:1904047 S-adenosyl-L-methionine binding
Biological Process
GO:0000154 rRNA modification
GO:0006364 rRNA processing
GO:0006391 transcription initiation at mitochondrial promoter
GO:0031167 rRNA methylation
GO:0032259 methylation
Cellular Component
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0042645 mitochondrial nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6aax, PDBe:6aax, PDBj:6aax
PDBsum6aax
PubMed31251801
UniProtQ8WVM0|TFB1M_HUMAN Dimethyladenosine transferase 1, mitochondrial (Gene Name=TFB1M)

[Back to BioLiP]