Structure of PDB 6a8r Chain A Binding Site BS01

Receptor Information
>6a8r Chain A (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQN
RRARHPGQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a8r DUX4HD2-DNAERGstructure reveals new insight into DUX4-Responsive-Element.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		R2 R3 R5 T6 R44 I47 N51 R55
Binding residue
(residue number reindexed from 1)		R1 R2 R4 T5 R43 I46 N50 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6a8r, PDBe:6a8r, PDBj:6a8r
PDBsum6a8r
PubMed30315230
UniProtQ9UBX2|DUX4_HUMAN Double homeobox protein 4 (Gene Name=DUX4)

[Back to BioLiP]