Structure of PDB 6a6l Chain A Binding Site BS01

Receptor Information
>6a6l Chain A (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPYLRSV
GDGETVEFDVVEGEKGAEAANVTGPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a6l Crystal structure of the cold shock domain of YB-1 in complex with m5C RNA
Resolution1.78 Å
Binding residue
(original residue number in PDB)
K64 W65 N67 N70 Y72 F74 D83 F85 H87 K118 G119
Binding residue
(residue number reindexed from 1)
K13 W14 N16 N19 Y21 F23 D32 F34 H36 K65 G66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6a6l, PDBe:6a6l, PDBj:6a6l
PDBsum6a6l
PubMed
UniProtP67809|YBOX1_HUMAN Y-box-binding protein 1 (Gene Name=YBX1)

[Back to BioLiP]