Structure of PDB 6a6j Chain A Binding Site BS01

Receptor Information
>6a6j Chain A (length=90) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRS
VGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a6j RNA 5-Methylcytosine Facilitates the Maternal-to-Zygotic Transition by Preventing Maternal mRNA Decay.
Resolution2.255 Å
Binding residue
(original residue number in PDB)		W45 N47 F54 F65 H67 E97 K98 G99 A100
Binding residue
(residue number reindexed from 1)		W13 N15 F22 F33 H35 E65 K66 G67 A68
Binding affinityPDBbind-CN: Kd=223nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6a6j, PDBe:6a6j, PDBj:6a6j
PDBsum6a6j
PubMed31399345
UniProtP67809|YBOX1_HUMAN Y-box-binding protein 1 (Gene Name=YBX1)

[Back to BioLiP]