Structure of PDB 6a4e Chain A Binding Site BS01

Receptor Information
>6a4e Chain A (length=181) Species: 167879 (Colwellia psychrerythraea 34H) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAGNDSNLIWLDLEMTGLEPVEDVILEIAIIITDSELNILAQGPIFAISQ
TDDVLDNMNPWCIEHHGKSGLTQRCRDSEVSLAHATKESLAFVQEWVPQG
KSPMCGNSIGQDRRFINKYMPDFEDHFHYRNLDVSTIKELAKRWKPEVLE
SVVKTGAHLALDAIKESIAELKVYRELFFKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a4e Structural basis of small RNA hydrolysis by oligoribonuclease (CpsORN) from Colwellia psychrerythraea strain 34H.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		E14 M15 G17 L18 W61 C62 H66 S108 S135
Binding residue
(residue number reindexed from 1)		E14 M15 G17 L18 W61 C62 H66 S108 S135
Enzymatic activity
Enzyme Commision number 3.1.15.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding
GO:0004527 exonuclease activity
GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
Biological Process
GO:0006259 DNA metabolic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6a4e, PDBe:6a4e, PDBj:6a4e
PDBsum6a4e
PubMed30804410
UniProtQ47VZ4|ORN_COLP3 Oligoribonuclease (Gene Name=orn)

[Back to BioLiP]