Structure of PDB 6a2h Chain A Binding Site BS01

Receptor Information
>6a2h Chain A (length=57) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHK
LPDDYPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a2h Architectural roles of Cren7 in folding crenarchaeal chromatin filament.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K24 W26 L28 A29 P30 K31 R33 L40
Binding residue
(residue number reindexed from 1)		K21 W23 L25 A26 P27 K28 R30 L37
Binding affinityPDBbind-CN: Kd=0.337uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6a2h, PDBe:6a2h, PDBj:6a2h
PDBsum6a2h
PubMed30499242
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]