Structure of PDB 6a2b Chain A Binding Site BS01

Receptor Information
>6a2b Chain A (length=272) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSLRYYYTAVSDRAFGLPEFSIVGYVDDTQSFRYNSDNQKAEPATQWM
KQKEGPEYWEQQTQIAKGSEPVHKHDVKTAMDRFNQTSGTHSLQVMYGCE
LREDNSIRSYHQYGYDGREFIALDTERWVYVPSVREAQLTEQKWNSPEVN
APERNKNYLQNLCIEGLKRYLSYGRAELERRVHPHVRISDHQSDDATELR
CHAYGFYPREIDVKWVKNGRADVHSEAAKEILPNPDGSYQLRVTAEITPS
EGDSYACHVEHSSLKEKLIVVW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a2b A Glimpse of the Peptide Profile Presentation byXenopus laevisMHC Class I: Crystal Structure of pXela-UAA Reveals a Distinct Peptide-Binding Groove.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Y7 Y58 Q62 I65 V72 D76 Y97 H111 Y113 T140 K143 W144 R154 N155 Y158 L162 R169 Y170
Binding residue
(residue number reindexed from 1)		Y7 Y58 Q62 I65 V72 D76 Y97 H111 Y113 T140 K143 W144 R154 N155 Y158 L162 R169 Y170
Enzymatic activity
Enzyme Commision number ?
External links