Structure of PDB 5zyu Chain A Binding Site BS01

Receptor Information
>5zyu Chain A (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NWFPIFNPERSDKVPLKIPLQRNVIPSVTRVLQQTMTKQQVFLLERWKQR
MILELGEDGFKEYTSNVFLQGKRFHEALESILSPQNLLKSGYIESVQHIL
KDVSGVRALESAVQHETLNYIGLLDCVAEYQGKLCVIDWKTSEKPKPFIQ
STFDNPLQVVAYMGAMNHDTNYSFQVQCGLIVVAYKDGSPAHPHFMDAEL
CSQYWTKWLLRLEEYTEKKKNQN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zyu Structural insights into DNA degradation by human mitochondrial nuclease MGME1
Resolution1.752 Å
Binding residue
(original residue number in PDB)
S132 T134 Q138 L149 W152 V172 F173 G176 K177 H180 G235 L236 D238 K253 T254 S255 E256 F266 Y275
Binding residue
(residue number reindexed from 1)
S27 T29 Q33 L44 W47 V67 F68 G71 K72 H75 G122 L123 D125 K140 T141 S142 E143 F153 Y162
Enzymatic activity
Enzyme Commision number 3.1.-.-
External links
PDB RCSB:5zyu, PDBe:5zyu, PDBj:5zyu
PDBsum5zyu
PubMed30247721
UniProtQ9BQP7|MGME1_HUMAN Mitochondrial genome maintenance exonuclease 1 (Gene Name=MGME1)

[Back to BioLiP]