Structure of PDB 5zwx Chain A Binding Site BS01

Receptor Information
>5zwx Chain A (length=148) Species: 3726 (Raphanus sativus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RIRLPPFLKPGAAVEISSNESGFRGSWYMGKVVAVPSSDSTTTKCEVEYT
TLFFDKEGRKRLREVVDVGQLRPPAPAVSEREKRREVAVGDDVDAFYSDG
WWEGTVTEVMGDGRMSVYFRASKEQIRFRRDELRFHREWVNGAWRPPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zwx Arabidopsis AGDP1 links H3K9me2 to DNA methylation in heterochromatin
Resolution1.9 Å
Binding residue
(original residue number in PDB)		E45 G47 F48 L77 F78 K81 E89 Y122 S123 D124 W127 F144 E149
Binding residue
(residue number reindexed from 1)		E20 G22 F23 L52 F53 K56 E64 Y97 S98 D99 W102 F119 E124
Enzymatic activity
Enzyme Commision number ?
External links