Structure of PDB 5zw4 Chain A Binding Site BS01

Receptor Information
>5zw4 Chain A (length=216) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDRYEQINDYIEALLKPRPDNVKRLEAYAEEHHVPIMEKAGMEVLLQILS
VKQPKKILEIGTAIGYSAIRMALELPSAEIYTIERNEKRHEEAVNNIKEF
QLDDRIHVFYGDALELADAVHVTAPYDVIFIDAAKGQYQNFFHLYEPMLS
PDGVIITDNVLFKGLVAEDYSKIEPKRRRRLVAKIDEYNHWLMNHPDYQT
AIIPVGDGLAISKKKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zw4 Identification of a novel tRNA wobble uridine modifying activity in the biosynthesis of 5-methoxyuridine.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
H34 P36 R86 R90 R178 R181
Binding residue
(residue number reindexed from 1)
H33 P35 R85 R89 R177 R180
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0008168 methyltransferase activity
GO:0008171 O-methyltransferase activity
GO:0016300 tRNA (uridine) methyltransferase activity
GO:0046872 metal ion binding
Biological Process
GO:0008033 tRNA processing
GO:0030488 tRNA methylation
GO:0032259 methylation

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5zw4, PDBe:5zw4, PDBj:5zw4
PDBsum5zw4
PubMed29982645
UniProtO32036|TRMR_BACSU tRNA 5-hydroxyuridine methyltransferase (Gene Name=trmR)

[Back to BioLiP]