Structure of PDB 5zuu Chain A Binding Site BS01

Receptor Information

>5zuu Chain A (length=162) Species: 3702 (Arabidopsis thaliana)

TSHPLPQGVNRYFVVKSNNRENFELSVQQGVWATQRSNEAKLNEAFDSVE
NVILIFSVNRTRHFQGCAKMTSRIGGYIGGGNWKHEHGTAQYGRNFSVKW
LKLCELSFHKTRNLRNPYNENLPVKISRDCQELEPSVGEQLASLLYLEPD
SELMAISIAAEA

Ligand information

>5zuu Chain E (length=5)

acuag

.....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5zuu CPSF30-L-mediated recognition of mRNA m6A modification controls alternative polyadenylation of nitrate signaling-related gene transcripts in Arabidopsis.
• Resolution: 1.95 Å
• Binding residue (original residue number in PDB): K243 S244 N245 N249 W259 A260 Q262 N286 R287 R289 W310 Y319 K352 S354 R355 D356
• Binding residue (residue number reindexed from 1): K16 S17 N18 N22 W32 A33 Q35 N59 R60 R62 W83 Y92 K125 S127 R128 D129

Enzymatic activity

• Enzyme Commision number: 3.1.21.-

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

External links

• PDB: RCSB:5zuu, PDBe:5zuu, PDBj:5zuu
• PDBsum: 5zuu
• PubMed: 33515769
• UniProt: A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 (Gene Name=CPSF30)