Structure of PDB 5zup Chain A Binding Site BS01

Receptor Information
>5zup Chain A (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMEQRILKFTTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWK
IAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zup Sequence preference and structural heterogeneity of BZ junctions.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
K169 K170 N173 R174 Y177 P192 P193
Binding residue
(residue number reindexed from 1)
K23 K24 N27 R28 Y31 P46 P47
Enzymatic activity
Enzyme Commision number 3.5.4.37: double-stranded RNA adenine deaminase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity

View graph for
Molecular Function
External links
PDB RCSB:5zup, PDBe:5zup, PDBj:5zup
PDBsum5zup
PubMed30184200
UniProtP55265|DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase (Gene Name=ADAR)

[Back to BioLiP]