Structure of PDB 5zuj Chain A Binding Site BS01

Receptor Information
>5zuj Chain A (length=153) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPT
AQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEI
MDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEV
STL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zuj Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R392 F410 E448 L456 L457 A458 R466 P468 K469 G470 F471 G472 Y473 T475
Binding residue
(residue number reindexed from 1)		R43 F61 E99 L107 L108 A109 R117 P119 K120 G121 F122 G123 Y124 T126
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0016567 protein ubiquitination
GO:0043122 regulation of canonical NF-kappaB signal transduction

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5zuj, PDBe:5zuj, PDBj:5zuj
PDBsum5zuj
PubMed30378729
UniProtQ9Y4K3|TRAF6_HUMAN TNF receptor-associated factor 6 (Gene Name=TRAF6)

[Back to BioLiP]