Structure of PDB 5ztm Chain A Binding Site BS01

Receptor Information
>5ztm Chain A (length=168) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDIKSFLYQFCAKSQIEPKFDIRQTGPKNRQRFLCEVRVEPNTYIGVGNS
TNKKDAEKNACRDFVNYLVRVGKLNTNDVPAIHGNWTIENAKERLNIYKQ
TNNIRDDYKYTPVGPEHARSFLAELSIYVPALNRTVTARESGSNKKSASK
SCALSLVRQLFHLNVIEP
Ligand information
>5ztm Chain C (length=49) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcuuuagagaucguuucgaaugauaaucguucgaaacguucuccgaagc
<<<<<.<<<<.<<<<<<<<<.........>>>>>>>>>.>>>>.>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ztm Structural insights reveal the specific recognition of roX RNA by the dsRNA-binding domains of the RNA helicase MLE and its indispensable role in dosage compensation in Drosophila.
Resolution2.899 Å
Binding residue
(original residue number in PDB)		D2 K4 S5 Y8 E17 K28 N29 F33 T51 N52 K53 K54 K58 K171 E172 N175 E195 H196 R198 F200 S222 N223 K224 K225
Binding residue
(residue number reindexed from 1)		D2 K4 S5 Y8 E17 K28 N29 F33 T51 N52 K53 K54 K58 K92 E93 N96 E116 H117 R119 F121 S143 N144 K145 K146
Binding affinityPDBbind-CN: Kd=0.2uM
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0003725 double-stranded RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5ztm, PDBe:5ztm, PDBj:5ztm
PDBsum5ztm
PubMed30649456
UniProtP24785|MLE_DROME Dosage compensation regulator mle (Gene Name=mle)

[Back to BioLiP]