Structure of PDB 5zs3 Chain A Binding Site BS01

Receptor Information
>5zs3 Chain A (length=113) Species: 216594 (Mycobacterium marinum M) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLGTSARPAVMPMDAWREGDKFVVEFDLPGIDADSLDIDIERNVVTVRAE
RPAVDPNREMLASERPRGVFSRQLVLGENLDTARIAASYTEGVLKLQIPV
AEKAKPRKISITR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zs3 Dodecameric structure of a small heat shock protein from Mycobacterium marinum M.
Resolution2.001 Å
Binding residue
(original residue number in PDB)		R34 F39 V92 G94 L97
Binding residue
(residue number reindexed from 1)		R17 F22 V75 G77 L80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051082 unfolded protein binding
Biological Process
GO:0006457 protein folding
GO:0009408 response to heat
GO:0009651 response to salt stress
GO:0042542 response to hydrogen peroxide
GO:0051259 protein complex oligomerization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5zs3, PDBe:5zs3, PDBj:5zs3
PDBsum5zs3
PubMed30632633
UniProtB2HF11

[Back to BioLiP]