Structure of PDB 5zpw Chain A Binding Site BS01

Receptor Information
>5zpw Chain A (length=35) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLLRAIEAQQHLLQLTVWGIKQLQARLLAVERYLK
Ligand information
>5zpw Chain B (length=24) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MTWEEWDKKIEKYTKKIEKLIKKS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zpw Generation of a long-acting fusion inhibitor against HIV-1.
Resolution2.199 Å
Binding residue
(original residue number in PDB)
Q563 I573 K574 Q577
Binding residue
(residue number reindexed from 1)
Q10 I20 K21 Q24
Enzymatic activity
Enzyme Commision number ?
External links