Structure of PDB 5zko Chain A Binding Site BS01

Receptor Information
>5zko Chain A (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKD
LYC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zko Structural Insights into the CRTC2-CREB Complex Assembly on CRE.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		L290 N293 R294 R298 R301 K305
Binding residue
(residue number reindexed from 1)		L6 N9 R10 R14 R17 K21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zko, PDBe:5zko, PDBj:5zko
PDBsum5zko
PubMed29733854
UniProtP16220|CREB1_HUMAN Cyclic AMP-responsive element-binding protein 1 (Gene Name=CREB1)

[Back to BioLiP]