Structure of PDB 5zk7 Chain A Binding Site BS01

Receptor Information

>5zk7 Chain A (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ANPEHYIKHPLQNRWALWFFKWQANLRLISKFDTVEDFWALYNHIQLSSN
LMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETL
LCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYK
ERLGLPPKIVIGYQSHADTATTKNRFVV

Ligand information

>5zk7 Chain C (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RYSRKQLLKLFR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5zk7 Structural insights reveal a recognition feature for tailoring hydrocarbon stapled-peptides against the eukaryotic translation initiation factor 4E protein.
Resolution	2.12 Å
Binding residue (original residue number in PDB)	L131 E132
Binding residue (residue number reindexed from 1)	L97 E98

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003743	translation initiation factor activity

	Biological Process
GO:0006413	translational initiation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zk7, PDBe:5zk7, PDBj:5zk7
PDBsum	5zk7
PubMed	30881679
UniProt	P06730\|IF4E_HUMAN Eukaryotic translation initiation factor 4E (Gene Name=EIF4E)

[Back to BioLiP]