Structure of PDB 5zk5 Chain A Binding Site BS01

Receptor Information

>5zk5 Chain A (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQ
LSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFW
LETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIG
RVYKERLGLPPKIVIGYQSHADTATTKNRFVV

Ligand information

>5zk5 Chain B (length=14) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KRYSREQLLKFQRK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5zk5 Structural insights reveal a recognition feature for tailoring hydrocarbon stapled-peptides against the eukaryotic translation initiation factor 4E protein.
Resolution	2.25 Å
Binding residue (original residue number in PDB)	H37 P38 Q40 V69 W73 E132 L135 G139 E140 R186
Binding residue (residue number reindexed from 1)	H7 P8 Q10 V39 W43 E102 L105 G109 E110 R156

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003743	translation initiation factor activity

	Biological Process
GO:0006413	translational initiation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zk5, PDBe:5zk5, PDBj:5zk5
PDBsum	5zk5
PubMed	30881679
UniProt	P06730\|IF4E_HUMAN Eukaryotic translation initiation factor 4E (Gene Name=EIF4E)

[Back to BioLiP]