Structure of PDB 5zjz Chain A Binding Site BS01

Receptor Information
>5zjz Chain A (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQL
SSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWL
ETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGR
VYKERLGLPPKIVIGYQSHADTATKTKNRFVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zjz Structural insights reveal a recognition feature for tailoring hydrocarbon stapled-peptides against the eukaryotic translation initiation factor 4E protein.
Resolution1.67 Å
Binding residue
(original residue number in PDB)		H37 P38 Q40 V69 W73 N77 E132 L135 G139 E140
Binding residue
(residue number reindexed from 1)		H6 P7 Q9 V38 W42 N46 E101 L104 G108 E109
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
Biological Process
GO:0006413 translational initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zjz, PDBe:5zjz, PDBj:5zjz
PDBsum5zjz
PubMed30881679
UniProtP06730|IF4E_HUMAN Eukaryotic translation initiation factor 4E (Gene Name=EIF4E)

[Back to BioLiP]