Structure of PDB 5zjr Chain A Binding Site BS01

Receptor Information
>5zjr Chain A (length=64) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EWTRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIW
FQNRRMKNKKNSQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zjr Intrinsic DNA Shape Accounts for Affinity Differences between Hox-Cofactor Binding Sites.
Resolution3.03 Å
Binding residue
(original residue number in PDB)		R23 Y43 Q68 R71 M72 K75
Binding residue
(residue number reindexed from 1)		R7 Y27 Q52 R55 M56 K59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5zjr, PDBe:5zjr, PDBj:5zjr
PDBsum5zjr
PubMed30157419
UniProtP09087|ABDB_DROME Homeobox protein abdominal-B (Gene Name=Abd-B)

[Back to BioLiP]