Structure of PDB 5zfy Chain A Binding Site BS01

Receptor Information
>5zfy Chain A (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWF
QNERSRQLRQHRRESPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREE
LARETGLPESRIQIWFQNRRARH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zfy Structural basis for multiple gene regulation by human DUX4.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R20 R21 R23 L24 W26 R62 N69 R73 R95 F118 R124 R146
Binding residue
(residue number reindexed from 1)		R3 R4 R6 L7 W9 R45 N52 R56 R69 F92 R98 R120
Binding affinityPDBbind-CN: Kd=68.03nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5zfy, PDBe:5zfy, PDBj:5zfy
PDBsum5zfy
PubMed30322619
UniProtQ9UBX2|DUX4_HUMAN Double homeobox protein 4 (Gene Name=DUX4)

[Back to BioLiP]