Structure of PDB 5z9x Chain A Binding Site BS01

Receptor Information
>5z9x Chain A (length=288) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELKLATAEKQVLDELVKLLQSRDLRGENGNWKEFLHVYDKNADSPSDPSR
RSHEDLVQFLTTFKKKEDLQLLKCHANHLLIENLKQESQDEDTPEQMLVR
LTVEHPSYSLDYSFKPYSEDWFVSDVGMKMKKVMESTNMVAVDCEMVLCE
DGTEGLVRVGVVDRDLKVILDEFVKPNKPVVDYRTDITGITAEDIENASL
SVVDIQETLQPFLSTGTILVGHSLNRDLEVLKIDHPKVIDTALVFKLRRP
SLNNLCKSILGYGVPHDCVHDASAAMKLALAVVEKRVD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z9x Structural and biochemical insights into small RNA 3' end trimming by Arabidopsis SDN1.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		D144 C145 E146 M147 R185 H223 S224 R227 R255 R256 P257 S258 L259 H278
Binding residue
(residue number reindexed from 1)		D143 C144 E145 M146 R184 H222 S223 R226 R248 R249 P250 S251 L252 H266
Binding affinityPDBbind-CN: Kd=124.5uM
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding
GO:0004527 exonuclease activity
GO:0005515 protein binding
GO:0008408 3'-5' exonuclease activity
GO:0035198 miRNA binding
GO:0044748 3'-5'-exoribonuclease activity involved in mature miRNA 3'-end processing
Biological Process
GO:0010587 miRNA catabolic process
GO:0044747 pre-miRNA 3'-end processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5z9x, PDBe:5z9x, PDBj:5z9x
PDBsum5z9x
PubMed30181559
UniProtA3KPE8|SDN1_ARATH Small RNA degrading nuclease 1 (Gene Name=SDN1)

[Back to BioLiP]