Structure of PDB 5z8n Chain A Binding Site BS01

Receptor Information

>5z8n Chain A (length=183) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRKELDSYTIKGTNKVVRAGDCVLMRPSDAGKPPYVARVEKIEADARNNV
KVHCRWYYRPEESLGGRRQFHGAKELFLSDHFDVQSAHTIEGKCIVHTFK
NYTRLENVGAEDYYCRFEYKAATGAFTPDRVAVYCKCEMPYNPDDLMVQC
EGCKDWYHPACVGMTIEEAKKLDHFVCAECSSD

Ligand information

>5z8n Chain P (length=5) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ARTKQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5z8n EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	Y148 Y155 M161 Q163 W170 L186
Binding residue (residue number reindexed from 1)	Y134 Y141 M147 Q149 W156 L172

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003682	chromatin binding

View graph for
Molecular Function

External links

PDB	RCSB:5z8n, PDBe:5z8n, PDBj:5z8n
PDBsum	5z8n
PubMed	30082787
UniProt	F4JL28\|EBS_ARATH Chromatin remodeling protein EBS (Gene Name=EBS)

[Back to BioLiP]