Structure of PDB 5z8l Chain A Binding Site BS01

Receptor Information
>5z8l Chain A (length=204) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKTRPGVASKIKTGRKELDSYTIKGTNKVVRAGDCVLMRPSDAGKPPYV
ARVEKIEADANVKVHCRWYYRPEESLGGRRQFHGAKELFLSDHFDVQSAH
TIEGKCIVHTFKNYTRLENVGAEDYYCRFEYKAATGAFTPDRVAVYCKCE
MPYNPDDLMVQCEGCKDWYHPACVGMTIEEAKKLDHFVCAECSSPADDVK
VRLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z8l EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
Resolution2.005 Å
Binding residue
(original residue number in PDB)		R40 W70 Y72 E76 H95 D97 Q99 T103 A135
Binding residue
(residue number reindexed from 1)		R40 W68 Y70 E74 H93 D95 Q97 T101 A133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0035064 methylated histone binding
GO:0046872 metal ion binding
GO:0140678 molecular function inhibitor activity
Biological Process
GO:0006325 chromatin organization
GO:0009791 post-embryonic development
GO:0009845 seed germination
GO:0009908 flower development
GO:0045814 negative regulation of gene expression, epigenetic
GO:0048579 negative regulation of long-day photoperiodism, flowering
GO:2000028 regulation of photoperiodism, flowering
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5z8l, PDBe:5z8l, PDBj:5z8l
PDBsum5z8l
PubMed30082787
UniProtF4JL28|EBS_ARATH Chromatin remodeling protein EBS (Gene Name=EBS)

[Back to BioLiP]