Structure of PDB 5z7i Chain A Binding Site BS01

Receptor Information
>5z7i Chain A (length=45) Species: 565050 (Caulobacter vibrioides NA1000) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSWTDERVSTLKKLWLDGLSASQIAKQLGGVTRNAVIGKVHRLGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z7i Structural insights into the unique mechanism of transcription activation by Caulobacter crescentus GcrA.
Resolution1.601 Å
Binding residue
(original residue number in PDB)		W15 S20 A21 R33 I37 H41
Binding residue
(residue number reindexed from 1)		W15 S20 A21 R33 I37 H41
Enzymatic activity
Enzyme Commision number ?
External links