Structure of PDB 5z6z Chain A Binding Site BS01

Receptor Information
>5z6z Chain A (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQ
NERSRQLRQHRRESPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREEL
ARETGLPESRIQIWFQNRRARH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z6z Structural basis for multiple gene regulation by human DUX4.
Resolution2.301 Å
Binding residue
(original residue number in PDB)		R20 R21 R23 L24 W26 R62 N69 R73 R95 R124 Q139 Q143 R146
Binding residue
(residue number reindexed from 1)		R2 R3 R5 L6 W8 R44 N51 R55 R68 R97 Q112 Q116 R119
Binding affinityPDBbind-CN: Kd=45.24nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5z6z, PDBe:5z6z, PDBj:5z6z
PDBsum5z6z
PubMed30322619
UniProtQ9UBX2|DUX4_HUMAN Double homeobox protein 4 (Gene Name=DUX4)

[Back to BioLiP]