Structure of PDB 5yyz Chain A Binding Site BS01

Receptor Information
>5yyz Chain A (length=102) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VAPAHLEVNEQTIPIVKHQLVKVGRNDKECQLVLTNPSISSVHCVFWCVF
FDEDSIPMFYVKDCSLNGTYLNGLLLKRDKTYLLKHCDVIELSTRLVFMI
ND
Ligand information
>5yyz Chain B (length=7) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IQPTQFV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yyz Structural insights into the recognition of phosphorylated Hop1 by Mek1
Resolution1.798 Å
Binding residue
(original residue number in PDB)		R51 P63 S64 I65 S66 S67 L92 N93
Binding residue
(residue number reindexed from 1)		R25 P37 S38 I39 S40 S41 L66 N67
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
External links
PDB RCSB:5yyz, PDBe:5yyz, PDBj:5yyz
PDBsum5yyz
PubMed30289413
UniProtP24719|MEK1_YEAST Meiosis-specific serine/threonine-protein kinase MEK1 (Gene Name=MEK1)

[Back to BioLiP]