Structure of PDB 5yy9 Chain A Binding Site BS01

Receptor Information
>5yy9 Chain A (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNEYVDARDTNMGAWFEAQVVRVTRKAPSRPALEEDVIYHVKYDDYPENG
VVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISR
KRETRTARELYANVVLGDSLNDCRIIFVDEVFKIERP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yy9 Structure of the UHRF1 Tandem Tudor Domain Bound to a Methylated Non-histone Protein, LIG1, Reveals Rules for Binding and Regulation.
Resolution2.653 Å
Binding residue
(original residue number in PDB)		D142 D145 M148 F152 E153 Y188 D190 Y191 N194 M224 R235 G236 W238 E276 F278
Binding residue
(residue number reindexed from 1)		D6 D9 M12 F16 E17 Y43 D45 Y46 N49 M79 R90 G91 W93 E130 F132
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:5yy9, PDBe:5yy9, PDBj:5yy9
PDBsum5yy9
PubMed30639225
UniProtQ96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 (Gene Name=UHRF1)

[Back to BioLiP]