Structure of PDB 5yvx Chain A Binding Site BS01

Receptor Information
>5yvx Chain A (length=60) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNSDKRFADCSKSQEMS
NEEINAELGI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yvx Uncovering the mechanistic basis for specific recognition of monomethylated H3K4 by the CW domain ofArabidopsishistone methyltransferase SDG8.
Resolution1.591 Å
Binding residue
(original residue number in PDB)		A864 W865 V866 R867 D869 W874 V882 I885 D886 E887 S889 N916 L919
Binding residue
(residue number reindexed from 1)		A3 W4 V5 R6 D8 W13 V21 I24 D25 E26 S28 N55 L58
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5yvx, PDBe:5yvx, PDBj:5yvx
PDBsum5yvx
PubMed29496997
UniProtQ2LAE1|ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 (Gene Name=ASHH2)

[Back to BioLiP]