Structure of PDB 5ytv Chain A Binding Site BS01

Receptor Information
>5ytv Chain A (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNKYLRSVG
DGETVEFDVVEGEKGAEAANVTGPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ytv Crystal structure of a Y-box binding protein 1 (YB-1)-RNA complex reveals key features and residues interacting with RNA.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		K64 W65 N67 N70 Y72 F74 D83 F85 H87 K118
Binding residue
(residue number reindexed from 1)		K13 W14 N16 N19 Y21 F23 D32 F34 H36 K64
Binding affinityPDBbind-CN: Kd=1.26uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:5ytv, PDBe:5ytv, PDBj:5ytv
PDBsum5ytv
PubMed31160337
UniProtP67809|YBOX1_HUMAN Y-box-binding protein 1 (Gene Name=YBX1)

[Back to BioLiP]