Structure of PDB 5ylx Chain A Binding Site BS01

Receptor Information
>5ylx Chain A (length=275) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLSYFSTAVSRPDRGDSRFIAVGYVDDTQFVRFDSDAPNPRMEPRVP
WIQQEGQEYWAEETRKVKDNAQTYRVNLKALRGYYNQSVAGSHTLQSMFG
CYLGPDGLLLHGYRQDAYDGADYIALNEDLRSWTAADMAAQITKRKWEAA
DAAEQMRSYLQGLCVESLRKYLEMGKDTLQRAEPPKTHVTRHPSSDLGAT
LRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVP
PGEEQSYTCHVQHEGLQEPLTLRWD
Ligand information
>5ylx Chain C (length=9) Species: 28344 (Porcine reproductive and respiratory syndrome virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TMPPGFELY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ylx Illumination of PRRSV Cytotoxic T Lymphocyte Epitopes by the Three-Dimensional Structure and Peptidome of Swine Lymphocyte Antigen Class I (SLA-I).
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 V67 N70 T73 N77 L81 Y84 L95 F99 D116 Y123 T143 K146 W147 Y159 S167 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 V67 N70 T73 N77 L81 Y84 L95 F99 D116 Y123 T143 K146 W147 Y159 S167 Y171
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
Cellular Component
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0042612 MHC class I protein complex
GO:0098553 lumenal side of endoplasmic reticulum membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ylx, PDBe:5ylx, PDBj:5ylx
PDBsum5ylx
PubMed31969884
UniProtH6TIB1

[Back to BioLiP]