Structure of PDB 5yl7 Chain A Binding Site BS01

Receptor Information

>5yl7 Chain A (length=339) Species: 394751 (Pseudoalteromonas arctica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

STPNDPRFDDQWHYYEQAGGLNLPTAWDTATGSGVVVAVLDTGYRPHADL
NANILPGYDMISNLSVANDGGGRDSDARDPGDAVAANECGTNGAQNSSWH
GTHVAGTVAAVTNNGEGVAGVAYNAKVVPVRVLGKCGGLTSDIADGIIWA
SGGSVSGIPANSNPADVINMSLGGSGSCSSTTQNAINTARSNGTVVVIAA
GNDNDNSANYNPGNCNGVVNVASVGRNGGRAYYSNYGSNIDVAAPGGAQS
FANDSEGVLSTYNSGSSTPSSDSYGYSQGTSMAAPHVAGVAALIKQAKPD
ATPDEIESILKSTTRSFPATCTSCGTGIVDAAAAVAAAS

Ligand information

>5yl7 Chain B (length=3) Species: 394751 (Pseudoalteromonas arctica) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5yl7 Crystal structure of a cold-active protease (Pro21717) from the psychrophilic bacterium, Pseudoalteromonas arctica PAMC 21717, at 1.4 angstrom resolution: Structural adaptations to cold and functional analysis of a laundry detergent enzyme
Resolution	1.4 Å
Binding residue (original residue number in PDB)	H244 G281 G282 L316 G317
Binding residue (residue number reindexed from 1)	H100 G137 G138 L172 G173

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0008236	serine-type peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5yl7, PDBe:5yl7, PDBj:5yl7
PDBsum	5yl7
PubMed	29466378
UniProt	A0A290S6P3

[Back to BioLiP]