Structure of PDB 5yip Chain A Binding Site BS01

Receptor Information
>5yip Chain A (length=123) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPGSEFMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDL
DKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQL
YEDNHEEDYFLYVAYSDESVYGK
Ligand information
>5yip Chain B (length=23) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PEDDWTEFSSEEIREARQAAASH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yip Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		Y5 E17 P30 K46 K48 Y49 L50 D54 Q59 F62 L63 K66 R67 F104
Binding residue
(residue number reindexed from 1)		Y11 E23 P36 K52 K54 Y55 L56 D60 Q65 F68 L69 K72 R73 F110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0008092 cytoskeletal protein binding
GO:0030957 Tat protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0043495 protein-membrane adaptor activity
Biological Process
GO:0006914 autophagy
GO:0061723 glycophagy
GO:0061753 substrate localization to autophagosome
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005776 autophagosome
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5yip, PDBe:5yip, PDBj:5yip
PDBsum5yip
PubMed29867141
UniProtQ8R3R8|GBRL1_MOUSE Gamma-aminobutyric acid receptor-associated protein-like 1 (Gene Name=Gabarapl1)

[Back to BioLiP]