Structure of PDB 5yf4 Chain A Binding Site BS01

Receptor Information
>5yf4 Chain A (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTP
KECPAIDYTRHTLDGAACLLNSAKLGSVCRRIYRIFSHAYFHHRQIFDEY
ENETFLCHRFTKFVMKYNLMSKDNLIVPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yf4 The MST4-MOB4 complex disrupts the MST1-MOB1 complex in the Hippo-YAP pathway and plays a pro-oncogenic role in pancreatic cancer.
Resolution1.897 Å
Binding residue
(original residue number in PDB)		Q105 W106 I107 F108 L109 A111 P116 E118 R161 R162 R165
Binding residue
(residue number reindexed from 1)		Q39 W40 I41 F42 L43 A45 P50 E52 R80 R81 R84
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5yf4, PDBe:5yf4, PDBj:5yf4
PDBsum5yf4
PubMed30072378
UniProtQ9Y3A3|PHOCN_HUMAN MOB-like protein phocein (Gene Name=MOB4)

[Back to BioLiP]