Structure of PDB 5yc3 Chain A Binding Site BS01

Receptor Information
>5yc3 Chain A (length=60) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSDHGETLCGACGDSDGADEFWICCDLCEKWFHGKCVKITPARAEHI
KQYKCPSCSN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yc3 Systematic Profiling of Histone Readers in Arabidopsis thaliana.
Resolution2.601 Å
Binding residue
(original residue number in PDB)		T5 G15 A16 D17 E18 F19 W20 I21 C22 W29 I45 K46
Binding residue
(residue number reindexed from 1)		T10 G20 A21 D22 E23 F24 W25 I26 C27 W34 I50 K51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042393 histone binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5yc3, PDBe:5yc3, PDBj:5yc3
PDBsum5yc3
PubMed29386129
UniProtQ9M2B4|ALFL3_ARATH PHD finger protein ALFIN-LIKE 3 (Gene Name=AL3)

[Back to BioLiP]