Structure of PDB 5ybv Chain A Binding Site BS01

Receptor Information
>5ybv Chain A (length=244) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MELSPDLISACLALEKYLDNPNALTERELKVAYTTVLQEWLRLACRSDAH
PELVRRHLVTFRAMSARLLDYVVNIADSNGNTALHYSVSHANFPVVQQLL
DSGVCKVDKQNRAGYSPIMLTALATLKTQDDIETVLQLFRLGNINAKASQ
AGQTALMLAVSHGRVDVVKALLACEADVNVQDDDGSTALMCACEHGHKEI
AGLLLAVPSCDISLTDRDGSTALMVALDAGQSEIASMLYSRMNI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ybv Structural basis for the recognition of kinesin family member 21A (KIF21A) by the ankyrin domains of KANK1 and KANK2 proteins.
Resolution2.12 Å
Binding residue
(original residue number in PDB)		N666 N668 Y673 S676 H677 N698 A700 Y702 Q740 H749 D771 S773 E781 H782 D803 D805 V812
Binding residue
(residue number reindexed from 1)		N79 N81 Y86 S89 H90 N111 A113 Y115 Q153 H162 D184 S186 E194 H195 D216 D218 V225
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0030837 negative regulation of actin filament polymerization

View graph for
Biological Process
External links
PDB RCSB:5ybv, PDBe:5ybv, PDBj:5ybv
PDBsum5ybv
PubMed29183992
UniProtQ63ZY3|KANK2_HUMAN KN motif and ankyrin repeat domain-containing protein 2 (Gene Name=KANK2)

[Back to BioLiP]