Structure of PDB 5ybu Chain A Binding Site BS01

Receptor Information
>5ybu Chain A (length=248) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQHEWFRVSSQ
KSAIPAMVGDYIAAFEAISPDVLRYVINLADGNGNTALHYSVSHSNFEIV
KLLLDADVCNVDHQNKAGYTPIMLAALAAVEAEKDMRIVEELFGCGDVNA
KASQAGQTALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHG
HVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLLYAHVNF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ybu Structural basis for the recognition of kinesin family member 21A (KIF21A) by the ankyrin domains of KANK1 and KANK2 proteins.
Resolution1.89 Å
Binding residue
(original residue number in PDB)		N1161 N1163 Y1168 N1193 Y1197 L1202 L1205 Q1235 H1244 E1266 S1268 C1273 E1276 H1277 D1298 D1300 I1307
Binding residue
(residue number reindexed from 1)		N83 N85 Y90 N115 Y119 L124 L127 Q157 H166 E188 S190 C195 E198 H199 D220 D222 I229
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0030837 negative regulation of actin filament polymerization

View graph for
Biological Process
External links
PDB RCSB:5ybu, PDBe:5ybu, PDBj:5ybu
PDBsum5ybu
PubMed29183992
UniProtQ14678|KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 (Gene Name=KANK1)

[Back to BioLiP]