Structure of PDB 5ybd Chain A Binding Site BS01

Receptor Information
>5ybd Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNM
NYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALLEHHHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ybd Comparative structure analysis of the ETSi domain of ERG3 and its complex with the E74 promoter DNA sequence
Resolution2.769 Å
Binding residue
(original residue number in PDB)		Y362 R367 R370 Y371 Y373 K380 R385 Y386
Binding residue
(residue number reindexed from 1)		Y52 R57 R60 Y61 Y63 K70 R75 Y76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5ybd, PDBe:5ybd, PDBj:5ybd
PDBsum5ybd
PubMed30279318
UniProtP11308|ERG_HUMAN Transcriptional regulator ERG (Gene Name=ERG)

[Back to BioLiP]