Structure of PDB 5y91 Chain A Binding Site BS01

Receptor Information
>5y91 Chain A (length=273) Species: 7959 (Ctenopharyngodon idella) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTHSLKYVYTGVSRGIDFPEFTAVGMVDDGQFMYFDSNSMKAVPKTEWIR
QNEGADYWDRQTQVLIGAHQVFKDSIQIVMERFNQSKGVHTWQNMYGCEL
NDDGTTQGFYQYAYDGEDFVSLDKNTLTWTAANPQAVITKHKWEALAVAE
QNKGYLENTCIEWLKKYVAYGKDTLERKVSPQVSLLQKDPSSPVTCHATG
FYPSGVTITWQKNGQDHDEDVDLGELLPNEDGSFQRMSTLNVGPWKNNRF
SCVVEHQDKTIRKTEDDIITNFD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5y91 Crystal structure of bony fish MHC class I complex at 1.9 Angstroms resolution.
Resolution1.901 Å
Binding residue
(original residue number in PDB)
Y8 Q62 V65 V72 D75 S76 W93 Y97 Y111 T140 K143 W144 Q152 Y156 W164 Y168
Binding residue
(residue number reindexed from 1)
Y7 Q61 V64 V71 D74 S75 W92 Y96 Y110 T139 K142 W143 Q151 Y155 W163 Y167
Enzymatic activity
Enzyme Commision number ?
External links