Structure of PDB 5y7w Chain A Binding Site BS01

Receptor Information
>5y7w Chain A (length=125) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIFEAQKIEWHEGAHMTGVESFMTKQDTTGKIISIDTSSLRAAGRTGWED
LVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSA
HTKCKLCYPQSPDMQPFIMGIHIID
Ligand information
>5y7w Chain C (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LLPPTEQDLKKLFKY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5y7w Targeted Inhibition of the NCOA1/STAT6 Protein-Protein Interaction
Resolution2.25 Å
Binding residue
(original residue number in PDB)		G270 I273 I275 V292 R293 Y297 F300 R311
Binding residue
(residue number reindexed from 1)		G30 I33 I35 V52 R53 Y57 F60 R71
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0030374 nuclear receptor coactivator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5y7w, PDBe:5y7w, PDBj:5y7w
PDBsum5y7w
PubMed29090910
UniProtP70365|NCOA1_MOUSE Nuclear receptor coactivator 1 (Gene Name=Ncoa1)

[Back to BioLiP]