Structure of PDB 5y20 Chain A Binding Site BS01

Receptor Information
>5y20 Chain A (length=52) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTLCGSCGGNYTNDEFWICCDVCERWYHGKCVKITPAKAESIKQYKCPSC
CT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5y20 Systematic Profiling of Histone Readers in Arabidopsis thaliana.
Resolution2.409 Å
Binding residue
(original residue number in PDB)		T5 N16 D17 F19 W20 I21 C22 E27 W29 K46
Binding residue
(residue number reindexed from 1)		T2 N13 D14 F16 W17 I18 C19 E24 W26 K43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042393 histone binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5y20, PDBe:5y20, PDBj:5y20
PDBsum5y20
PubMed29386129
UniProtQ9FFF5|ALFL1_ARATH PHD finger protein ALFIN-LIKE 1 (Gene Name=AL1)

[Back to BioLiP]