Structure of PDB 5xyf Chain A Binding Site BS01

Receptor Information
>5xyf Chain A (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVAGPAALRFAAAASWQVVRGRCVEHFPRVLEFLRSLRAVAPGLVRYRHH
ERLCMGLKAKVVVELILQGRPWAQVLKALNHHFPESGRDPKATKQDLRKI
LEAQETFYQQVKQLSEAPVDLASKLQELEQEYGEPFLAAMEKLLFEYLCQ
LEKALPTPQAQQLQDVLSWMQPGVSITSSLAWRQYGVDMGWL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xyf Structural and functional analyses of the mammalian TIN2-TPP1-TRF2 telomeric complex.
Resolution2.202 Å
Binding residue
(original residue number in PDB)		R52 R56 K106 E109 A110 T113 F114 E138 Y139 P142 F143
Binding residue
(residue number reindexed from 1)		R48 R52 K99 E102 A103 T106 F107 E131 Y132 P135 F136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0016233 telomere capping
Cellular Component
GO:0070187 shelterin complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xyf, PDBe:5xyf, PDBj:5xyf
PDBsum5xyf
PubMed29160297
UniProtQ9BSI4|TINF2_HUMAN TERF1-interacting nuclear factor 2 (Gene Name=TINF2)

[Back to BioLiP]