Structure of PDB 5xxf Chain A Binding Site BS01

Receptor Information
>5xxf Chain A (length=222) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCH
EKMPIFMDIAFIEYCFNLSLDPDSQQILWEYSLISNALERLENIELERQN
CMRENKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFTKFLQDW
GSHNEKEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSRYIQCTK
LQLEVFCDYDFKQREIVKMLTS
Ligand information
>5xxf Chain E (length=17) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NSDNIFVKPGEDLEIPL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xxf Structure of the fission yeast S. pombe telomeric Tpz1-Poz1-Rap1 complex.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T132 E136 C143 R150 E181 M207 R218 Q221 C222
Binding residue
(residue number reindexed from 1)		T108 E112 C119 R126 E157 M183 R194 Q197 C198
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0000723 telomere maintenance
GO:0016233 telomere capping
GO:0032200 telomere organization
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070187 shelterin complex
GO:0140445 chromosome, telomeric repeat region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xxf, PDBe:5xxf, PDBj:5xxf
PDBsum5xxf
PubMed29160296
UniProtO13852|POZ1_SCHPO Protection of telomeres protein poz1 (Gene Name=poz1)

[Back to BioLiP]