Structure of PDB 5xw9 Chain A Binding Site BS01

Receptor Information
>5xw9 Chain A (length=124) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRL
GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRV
ATVSLPRSCAAAGTECLISGWGNT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xw9 Tripeptides derived from reactive centre loop of potato type II protease inhibitors preferentially inhibit midgut proteases of Helicoverpa armigera.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		H48 L89
Binding residue
(residue number reindexed from 1)		H40 L81
Enzymatic activity
Catalytic site (original residue number in PDB) H48 D92
Catalytic site (residue number reindexed from 1) H40 D84
Enzyme Commision number 3.4.21.4: trypsin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5xw9, PDBe:5xw9, PDBj:5xw9
PDBsum5xw9
PubMed29486250
UniProtP00761|TRYP_PIG Trypsin

[Back to BioLiP]