Structure of PDB 5xvw Chain A Binding Site BS01

Receptor Information
>5xvw Chain A (length=132) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPRTVEEIFKDYSARRAALLRALTKDVDDFYSQCDPEKENLCLYGHPNES
WEVNLPAEEVPPELPEPALGINFARDGMQRKDWLSLVAVHSDCWLLSVSF
YFGARLNRNERKRLFSLINDLPTLFDVVTGRK
Ligand information
>5xvw Chain D (length=12) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ILAWGRGGTRSN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xvw Structural Analysis of the Arabidopsis AL2-PAL and PRC1 Complex Provides Mechanistic Insight into Active-to-Repressive Chromatin State Switch
Resolution1.849 Å
Binding residue
(original residue number in PDB)		P64 A65 E66 E67 V68 P69 P70 E74 R113
Binding residue
(residue number reindexed from 1)		P56 A57 E58 E59 V60 P61 P62 E66 R105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042393 histone binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5xvw, PDBe:5xvw, PDBj:5xvw
PDBsum5xvw
PubMed30176245
UniProtQ9SRM4|ALFL2_ARATH PHD finger protein ALFIN-LIKE 2 (Gene Name=AL2)

[Back to BioLiP]