Structure of PDB 5xtz Chain A Binding Site BS01

Receptor Information
>5xtz Chain A (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQF
KLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLL
KLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xtz Gas41 links histone acetylation to H2A.Z deposition and maintenance of embryonic stem cell identity.
Resolution2.105 Å
Binding residue
(original residue number in PDB)		H71 S73 Y74 G92 W93 G94 E95 F121
Binding residue
(residue number reindexed from 1)		H53 S55 Y56 G74 W75 G76 E77 F103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5xtz, PDBe:5xtz, PDBj:5xtz
PDBsum5xtz
PubMed29900004
UniProtO95619|YETS4_HUMAN YEATS domain-containing protein 4 (Gene Name=YEATS4)

[Back to BioLiP]