Structure of PDB 5xsk Chain A Binding Site BS01

Receptor Information
>5xsk Chain A (length=90) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFFGTHETAF
LGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xsk Structure of PWWP-DNA complex at 2.84 Angstroms resolution
Resolution2.84 Å
Binding residue
(original residue number in PDB)
K78 R79 K80
Binding residue
(residue number reindexed from 1)
K71 R72 K73
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5xsk, PDBe:5xsk, PDBj:5xsk
PDBsum5xsk
PubMed
UniProtQ8VHK7|HDGF_RAT Hepatoma-derived growth factor (Gene Name=Hdgf)

[Back to BioLiP]