Structure of PDB 5xs3 Chain A Binding Site BS01

Receptor Information
>5xs3 Chain A (length=271) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSMRYFDTAVSRPGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVE
QEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQWMYGCDL
GPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREA
EQWRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRC
WALGFYPARITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGE
EQRYTCHVQHEGLPEPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xs3 Characterization of Autoantigen Presentation by HLA-C*06:02 in Psoriasis
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y7 D9 E63 K66 Y67 R69 Q70 N77 K80 L81 Y84 W97 Y99 T143 K146 W147 E152 Q155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y6 D8 E60 K63 Y64 R66 Q67 N74 K77 L78 Y81 W94 Y96 T140 K143 W144 E149 Q152 Y156 W164 Y168
External links